PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_1EA22121D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 132aa    MW: 15275.5 Da    PI: 9.7292
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_1EA22121D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof82.35.2e-263272242
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtk 42
                           +e++++cprC+s ntkfCyynnys+sqPryfCkaCrryWt+
  Traes_5AL_1EA22121D.1 32 PEQKVECPRCKSGNTKFCYYNNYSMSQPRYFCKACRRYWTH 72
                           7899************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-193072IPR003851Zinc finger, Dof-type
PfamPF027017.6E-223472IPR003851Zinc finger, Dof-type
PROSITE profilePS5088420.6543690IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MEEVFPSNSK SKAGQMAGEA TAAAEKKPRP KPEQKVECPR CKSGNTKFCY YNNYSMSQPR  60
YFCKACRRYW THXXXXXXXX XXXXPQAQAP GDLRRPQARR GLLVRTHGCH AALDLHRDEL  120
CQRPPNIYVC WF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0581351e-115KX058135.1 Triticum aestivum prolamin binding factor (Dof) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5EV931e-84W5EV93_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.39e-21Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]